AnaSpec Introduces Ninety-Seven New Catalog Peptides
Released on: March 6, 2008, 1:49 pm
Press Release Author: AnaSpec Inc.
Industry: Biotech
Press Release Summary: This week AnaSpec, one of the world's largest providers of custom and catalog peptides, introduced ninety-seven (97) new catalog peptides.
Press Release Body: March 6, 2008 - San Jose, CA
This week AnaSpec, one of the world's largest providers of custom and catalog peptides, introduced ninety-seven (97) new catalog peptides.
[NMeG24; NMeI26] Human Islet Amyloid Polypeptide (IAPP) (22-27)- Cat# 61937 This amino acids 22 to 27 fragment is a modification of the human islet amyloid polypeptide hIAPP (NFGAIL) with N-methylation of the amide bonds at G24 and I26. The introduction of two N-methyl rests in the amyloid-core-containing sequence NFGAIL converts this amyloidogenic and cytotoxic sequence into non-amyloidogenic and non-cytotoxic peptide. The peptide is able to bind with high-affinity full-length hIAPP and to inhibit its fibrillogenesis. Sequence: NF-(NMe-G)-A-(NMe-I)-L
[Ala20]-beta-Amyloid (1-42)- Cat# 62446 This is a modified beta-Amyloid (1-42); with Phe20 replaced by Ala20. Sequence: DAEFRHDSGYEVHHQKLVFAAEDVGSNKGAIIGLMVGGVVIA
[Cys40]-beta-hairpin (BHA); Protein G B1 Domain (41-56)- Cat# 62533 This ?-hairpin (BHA) peptide is amino acid residues 41 to 56 fragment from the B1 domain of protein G. BHA peptide adopts a stable ?-hairpin structure in aqueous solution with a population of 40%. In water; BHA adopts a twisted conformation around the peptide axis. In 30% (vol/vol) TFE/water solution; the ?-hairpin population further increases up to
Web Site: http://www.anaspec.com
Contact Details: AnaSpec Inc. 2149 O\'Toole Ave. San Jose, CA 95131 1-408-452-5055 (Tel) 1-408-452-5059 (Fax) 1-800-452-5530 ping@anaspec.com www.anaspec.com
Printer
Friendly Format
Back
to previous page...
Back
to home page...
Submit
your press releases...
|